PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018396m
Common NameEUTSA_v10018396mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 527aa    MW: 58887.7 Da    PI: 5.1148
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018396mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.64.3e-26191245155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r++W+ eLH++Fv+av+q+G  +kA Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Thhalv10018396m 191 KARVVWSFELHQKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVASHLQKYRL 245
                      68****************************************************8 PP

2Response_reg80.26.8e-27121181107
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+vdD+p+ +++l+++l+k  y ev+++  ++eal+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ 
  Thhalv10018396m  12 VLVVDDDPTWLKILEKMLKKCSY-EVTTCGLAREALRLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEL-DLPVIMMSVDGETSRVMKGVQH 103
                      89*********************.***************999999**********************5543.7********************* PP

                      TESEEEESS--HHHH CS
     Response_reg  93 GakdflsKpfdpeel 107
                      Ga d+l Kp+ ++el
  Thhalv10018396m 104 GACDYLLKPIRMKEL 118
                      **********99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.3E-1441510IPR017053Response regulator B-type, plant
SuperFamilySSF521721.71E-359131IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-439133No hitNo description
SMARTSM004485.6E-3210122IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.75511126IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.9E-2412119IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.32E-3113126No hitNo description
Gene3DG3DSA:1.10.10.608.3E-28188250IPR009057Homeodomain-like
SuperFamilySSF466893.4E-16189249IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-22191245IPR006447Myb domain, plants
PfamPF002492.1E-7193244IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MEKGFTPVGL RVLVVDDDPT WLKILEKMLK KCSYEVTTCG LAREALRLLR ERKDGYDIVI  60
SDVNMPDMDG FKLLEHVGLE LDLPVIMMSV DGETSRVMKG VQHGACDYLL KPIRMKELKI  120
IWQHVLRKKL QEVKDIEGSC CYEGGADWII RNDEAHFLGG GEDVSFGKRR KDFDFEKKLL  180
QDESDPSSSK KARVVWSFEL HQKFVNAVNQ IGCDHKAGPK KILDLMNVPW LTRENVASHL  240
QKYRLYLSRL EKGKELKCYS GGAKNIDSPP KDADLNSGHQ SPGKSSYAFS VGSSLLHKAT  300
ETDPKPLASA SVSDPNSDVH MPPKAKKTRI GFDPPLSSTA FDSLLPWNDV PDPLESKPPI  360
LYENNFLQPS QSSYVSNSAP SLMEEEMKLS YETPAGGTCV NADEFLKSPT VTLQDLDLSA  420
PSAISCMKLQ EFSSNVTNST ESILRSLSWE FPESHHSGSL DTDLDFSWLQ GEHFLANTGL  480
QNFQFQDYSS STSLLSELPP HLWFGNERLP DPDEYSLLVD QGLFIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17187250163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0415320.0AB041532.1 Arabidopsis thaliana ARR11 mRNA for response regulator 11, complete cds.
GenBankAK2282160.0AK228216.1 Arabidopsis thaliana mRNA for response regulator 11, complete cds, clone: RAFL14-66-N10.
GenBankBT0087680.0BT008768.1 Arabidopsis thaliana At1g67710 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391233.10.0hypothetical protein EUTSA_v10018396mg
SwissprotQ9FXD60.0ARR11_ARATH; Two-component response regulator ARR11
TrEMBLV4KBQ90.0V4KBQ9_EUTSA; Uncharacterized protein
STRINGscaffold_201596.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80662740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.10.0response regulator 11